PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_895AA6D35.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 75aa    MW: 9061.54 Da    PI: 10.7972
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_895AA6D35.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-121461055
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                           ++kNRe+A rsR+RK+a++ eLe +v++L+  N++L  + +e+ ++
  Traes_5DL_895AA6D35.1  1 MIKNRESAARSRARKQAYTMELEAEVQKLKDLNEELVRKQKEILEM 46
                           68*******************************9887666665444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579591.55E-9143No hitNo description
PfamPF001702.3E-9146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.5E-11144No hitNo description
PROSITE profilePS502179.013143IPR004827Basic-leucine zipper domain
SMARTSM003380.0037150IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MIKNRESAAR SRARKQAYTM ELEAEVQKLK DLNEELVRKQ KEILEMQKRE QAPEMKDQFG  60
RKKRQCLRRT LTGPW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3628201e-116AB362820.1 Triticum aestivum Wabi5-3 mRNA for basic region leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578228.15e-38PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF32e-27TRAB1_ORYSJ; bZIP transcription factor TRAB1
SwissprotQ9M7Q32e-27AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLW5FJ426e-46W5FJ42_WHEAT; Uncharacterized protein
TrEMBLW5FVN31e-47W5FVN3_WHEAT; Uncharacterized protein
STRINGMLOC_66546.26e-43(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.32e-29ABRE binding factor 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]